Trending peptide

LL-37

Also called Ropocamptide, Cathelicidin LL-37, Human cathelicidin antimicrobial peptide LL-37, hCAP18(134-170), CAMP peptide.

LL-37 is a small protein piece that the human body makes itself to fight germs and help skin heal. It has been tested in only a few small human studies, on leg ulcers and on melanoma skin tumours. No regulator has approved it as a medicine, and there is no proof that it works or is safe when used outside a trial.

LL-37 is not an approved medicine for these uses in most countries. This page explains the science and the law; it does not give dosing, sourcing or usage advice.

How strong is the evidence?

AnecdoteAnimalsHuman trialsApproved
Small human. Small or uncontrolled studies in people.Human data are limited to two small, early studies. (1) A first-in-man trial in 34 people with hard-to-heal venous leg ulcers: 3-week placebo run-in, then a 4-week randomised, double-blind treatment phase with topical LL-37 or placebo, and 4 weeks of follow-up. The lower two of three strengths healed faster than placebo (healing rate constants about six- and three-fold higher; p = 0.003 and p = 0.088), the highest strength did not differ from placebo, and no safety concerns were reported. (2) A phase 1/2 single-arm study of injections into melanoma skin tumours at MD Anderson (NCT02225366), which enrolled only 4 people; posted results cover 3 and are too small to judge efficacy. A randomised phase 2 diabetic-foot-ulcer cream trial (NCT04098562, planned 40 participants) is registered with unknown status (last known: not yet recruiting, 2019) and no results. Everything else, including the antimicrobial, immune and wound-healing mechanisms, comes from cell, tissue and animal experiments. There is no phase 3 trial and no regulatory approval.

Last verified 2026-09-29 · how we verify

7. R · Arginine25. K · Lysine32. V · Valine14. G · Glycine36. E · Glutamate18. K · Lysine3. G · Glycine21. V · Valine29. R · Arginine11. E · Glutamate28. L · Leucine10. K · Lysine4. D · Aspartate22. Q · Glutamine17. F · Phenylalanine35. T · Threonine15. K · Lysine33. P · Proline6. F · Phenylalanine24. I · Isoleucine8. K · Lysine26. D · Aspartate13. I · Isoleucine31. L · Leucine37. S · Serine1. L · Leucine19. R · Arginine2. L · Leucine20. I · Isoleucine30. N · Asparagine12. K · Lysine9. S · Serine27. F · Phenylalanine5. F · Phenylalanine23. R · Arginine34. R · Arginine16. E · GlutamateNC

Schematic

  • Water-avoiding
  • Glycine or proline
  • Negative charge
  • Positive charge
  • Water-loving

Schematic from the amino-acid sequence — not an experimental structure

37 amino acids, one bead each, coloured by type, N-terminus to C-terminus. The helix shape is illustrative; it is not the real 3D shape of LL-37.

Acts on
Anionic bacterial membranes and lipopolysaccharide: direct antimicrobial action, shown in laboratory studies, Formyl peptide receptor-like 1 (FPRL1, also called FPR2): white-blood-cell recruitment, shown in human cells in the laboratory, P2X7 receptor: interleukin-1 beta release, shown in human monocytes in the laboratory, Epidermal growth factor receptor (transactivated indirectly): epithelial cell signalling, shown in human airway cells in the laboratory, Self-DNA complexes sensed by Toll-like receptor 9 in plasmacytoid dendritic cells: shown in human psoriasis skin and human cells
Taken as
Not given by any approved route, because it is not approved. In clinical studies it has been tested as a topical preparation applied to venous leg ulcers, as injections directly into melanoma skin tumours (intratumoral) at a cancer centre, and, in a registered trial with unknown status, as a cream on diabetic foot ulcers. Systemic use has not been studied in a published human trial that I found.
Molecule
37 amino acids, C205H340N60O53, molecular weight about 4,493; the INN is ropocamptide. It equals residues 134-170 of the human precursor hCAP-18.[src]
Where it comes from
LL-37 is cut from the only human cathelicidin precursor, hCAP-18 (170 amino acids; CAMP gene), by proteinase 3 after neutrophil release.[src]
Only published randomised human trial found
34 participants with hard-to-heal venous leg ulcers; the two lower topical strengths had healing rate constants about six- and three-fold higher than placebo (p = 0.003 and p = 0.088); no safety concerns reported. Published 2014.[src]
Melanoma injection study
NCT02225366 (phase 1/2, MD Anderson, completed 24 November 2020) enrolled 4 participants; results were posted for 3.[src]

Inside the body

What LL-37 does, step by step

Watch the 3D journey →
  1. 01Immune system

    The body makes it as an inactive precursor

    Your white blood cells and skin cells make a longer, inactive form of the protein and store it. A vitamin D signal can turn up how much is made. Cutting the longer protein at the right spot frees the active piece, LL-37.

    For experts

    LL-37 is the C-terminal 37 residues of the 170-residue precursor hCAP-18 (CAMP gene; residues 134-170). hCAP-18 is stored in neutrophil granules and, after exocytosis, proteinase 3 alone among the azurophil-granule serine proteases cleaved it to LL-37 in the study of Sørensen et al. The CAMP promoter contains a vitamin D response element bound by the vitamin D receptor, so 1,25-dihydroxyvitamin D3 induced CAMP in human myeloid, keratinocyte and colon-cancer cell lines and in primary human bone-marrow macrophages, and Toll-like receptor activation of human macrophages raised cathelicidin through the vitamin D pathway. These are human-cell laboratory findings. The response element is present in primates but not in mouse, rat or dog genomes, so rodents are an imperfect model.[src][src][src]

  2. 02Skin

    Skin injury switches it on

    When skin is cut, the skin and nearby white blood cells make a lot more of this protein for a couple of days. Long-lasting ulcers seem to be low in it at the wound edge, which is one reason it was tried as a treatment.

    For experts

    In human skin wounds, hCAP18 rose after injury, peaked at about 48 hours, and fell back to baseline on wound closure; it was found in the inflammatory infiltrate and the migrating epithelium. In chronic ulcers, levels were low and immunoreactivity was absent in ulcer-edge epithelium. In an ex vivo organ-cultured human skin wound model, affinity-purified anti-LL-37 antibodies reduced re-epithelialisation in a concentration-dependent way, and Ki67 staining was lost in inhibited wounds, suggesting a role in epithelial proliferation. This is correlational and ex vivo evidence; it does not by itself show that supplying LL-37 heals ulcers.[src]

  3. 03Immune system

    It punches through germ membranes

    LL-37 is positively charged and germ surfaces are negatively charged, so it sticks to them. It bends into a spiral shape and damages the germ's outer skin. At high levels in a dish it can also hurt human cells, but adding human blood serum blocked that in the tests.

    For experts

    LL-37 is cationic and amphipathic. In water it is disordered; anions and increasing peptide concentration drove a cooperative transition to an alpha-helix consistent with oligomer formation, and helicity correlated with antibacterial activity. The NMR structure in micelles shows a curved helix-bend-helix spanning residues 2-31 with a disordered C-terminal tail, and aromatic and arginine side chains contacting anionic lipid micelles. The minimal inhibitory concentration against E. coli was 5 micromolar, while cytotoxicity against several eukaryotic cell types appeared at 13-25 micromolar; human serum inhibited both antibacterial and cytotoxic activity. These are in vitro results.[src][src]

  4. 04Immune system

    It calls in other immune cells

    LL-37 also works like a flare. It attracts white blood cells to the spot and can set off a signal that makes them release an alarm chemical called interleukin-1 beta. These effects were shown in human cells in the lab.

    For experts

    LL-37 was chemotactic for human monocytes, neutrophils and T cells and induced Ca2+ mobilisation in FPRL1-transfected HEK293 cells and in monocytes, with cross-desensitisation by an FPRL1-specific agonist, indicating FPRL1 (FPR2) as a receptor. In LPS-primed human monocytes, LL-37 triggered ATP release, membrane permeability, caspase-1 activation and IL-1 beta release via P2X7, without cytotoxicity in that system. Both findings come from cell experiments; in vivo relevance in humans is inferred rather than proven.[src][src]

  5. 05Skin

    It nudges lining cells to grow and signal

    LL-37 can also talk to the cells that line the skin and airways. In lab dishes it switches on their growth and alarm signals. This may be part of how it helps wounds close, but that link has not been proven in people.

    For experts

    In human airway epithelial cells, LL-37 activated MAPK/ERK and IL-8 release through metalloproteinase-mediated shedding of membrane-anchored EGFR ligands and consequent EGFR transactivation, with blocking by EGFR kinase, MEK and metalloproteinase inhibitors. This was shown in airway cells, not skin; the skin-wound data in the previous step point to a proliferative role but do not identify the receptor.[src][src]

  6. 06Immune system

    Too much can drive inflammation

    In psoriasis and rosacea, skin has too much LL-37 or unusual cut-up forms of it. It can bind the body's own DNA and trick immune cells into thinking there is a virus, which fuels swelling and redness. So more LL-37 is not always better.

    For experts

    In psoriatic skin, LL-37 bound self-DNA into aggregated, condensed complexes retained in early endosomes of human plasmacytoid dendritic cells, triggering TLR9 and type I interferon production, proposed as a driver of autoimmunity in psoriasis. In rosacea, patients' facial skin had abnormally high cathelicidin and different proteolytic fragments, associated with raised stratum corneum tryptic enzyme; in mice, injecting rosacea-type fragments or adding the enzyme increased skin inflammation, and Camp-deficient mice lacked the enzyme-driven inflammation. Human data here are observational or ex vivo; the causal experiments were in mice.[src][src]

  7. 07Skin

    Applied to leg ulcers, early results looked promising

    In one small trial, people with stubborn leg ulcers who got the lower two strengths of LL-37 on the wound healed faster than those on placebo. The highest strength did not help. The trial was small and short, so it needs repeating.

    For experts

    In the first-in-man randomised, double-blind, placebo-controlled trial (34 participants with hard-to-heal venous leg ulcers, twice-weekly topical applications for 4 weeks after a 3-week placebo run-in), healing rate constants for the two lower strengths were about six- and three-fold higher than placebo (p = 0.003 and p = 0.088); mean ulcer area fell 68% and 50% in those groups; the highest strength did not differ from placebo; no local or systemic safety concerns were reported. The authors called for further investigation. I did not find a published larger follow-up trial in the sources I checked.[src]

  8. 08Skin

    Injected into melanoma tumours in a tiny study

    Researchers also injected LL-37 into melanoma skin tumours in a very small study of four people, hoping to wake up the immune system against the cancer. That study cannot show whether it works. One person developed unusual skin growths that cleared after treatment stopped.

    For experts

    NCT02225366 was a single-arm phase 1/2 dose-finding study of weekly intratumoral LL-37 injections into cutaneous or subcutaneous melanoma lesions, motivated by preclinical evidence of plasmacytoid dendritic cell activation. It enrolled 4 people; the posted results cover 3. A published case report from this programme described a patient with stage IIIC melanoma who had shrinkage of injected lesions but developed multiple verrucous papules and a vesiculo-bullous lesion with lichenoid infiltrate and keratoacanthoma-like epithelial atypia about 45 days after starting, which resolved within 2 months of stopping. Separately, a 2023 study found LL-37 staining rose with melanoma T stage and that LL-37 stimulated pro-angiogenic and matrix-degrading factors in melanoma cells and macrophages in vitro, raising the possibility of tumour promotion. Evidence on tumour effects is conflicting and minimal.[src][src][src]

For experts

The detail

LL-37 (INN ropocamptide; C205H340N60O53, about 4,493 Da) is the 37-residue, C-terminal antimicrobial peptide ([LL-37, 37 aa]) of hCAP-18, the only human cathelicidin, encoded by CAMP. It corresponds to residues 134-170 of the 170-residue precursor (UniProt P49913). hCAP-18 is stored in neutrophil peroxidase-negative (specific) granules and made by epithelial cells; after release, proteinase 3 cleaves off LL-37 (Sørensen 2001), and the CAMP promoter carries a vitamin D response element, conserved in primates, through which 1,25-dihydroxyvitamin D3 induced CAMP in human myeloid and keratinocyte cell lines (Gombart 2005). The native peptide is unmodified and has no engineered stabilising groups. It is cationic and amphipathic, disordered in water, and forms an alpha-helix with a bend near Gly14-Glu16 in the presence of anions, lipid micelles or membranes; it also oligomerises (Johansson 1998; Wang 2008). Antibacterial activity is membrane-directed; the same peptide was cytotoxic to several eukaryotic cell types at 13-25 micromolar in vitro, and human serum inhibited that activity (Johansson 1998). It is also a signalling molecule: it chemoattracts neutrophils, monocytes and T cells through FPRL1 (Yang 2000), promotes P2X7-dependent IL-1 beta release (Elssner 2004), transactivates EGFR in airway epithelial cells (Tjabringa 2003), and binds self-DNA to trigger TLR9-driven interferon production in plasmacytoid dendritic cells in psoriasis (Lande 2007). I found no published human pharmacokinetic study and no half-life. It is not approved by any regulator I checked. Clinical experience is limited to two small studies: a 34-participant first-in-man randomised, placebo-controlled topical dose-ranging trial in hard-to-heal venous leg ulcers (Grönberg 2014) and a phase 1/2 intratumoral melanoma study (NCT02225366) that enrolled 4 people. FDA lists cathelicidin LL-37 among bulk substances that were nominated for compounding and then withdrawn, and states concerns about immunogenicity for some routes, peptide impurities and characterisation, and nonclinical signals of harm to male reproduction and of tumour promotion in some tissues.

Evidence: Human data are limited to two small, early studies. (1) A first-in-man trial in 34 people with hard-to-heal venous leg ulcers: 3-week placebo run-in, then a 4-week randomised, double-blind treatment phase with topical LL-37 or placebo, and 4 weeks of follow-up. The lower two of three strengths healed faster than placebo (healing rate constants about six- and three-fold higher; p = 0.003 and p = 0.088), the highest strength did not differ from placebo, and no safety concerns were reported. (2) A phase 1/2 single-arm study of injections into melanoma skin tumours at MD Anderson (NCT02225366), which enrolled only 4 people; posted results cover 3 and are too small to judge efficacy. A randomised phase 2 diabetic-foot-ulcer cream trial (NCT04098562, planned 40 participants) is registered with unknown status (last known: not yet recruiting, 2019) and no results. Everything else, including the antimicrobial, immune and wound-healing mechanisms, comes from cell, tissue and animal experiments. There is no phase 3 trial and no regulatory approval.[src][src][src]

Known safety signals

  • FDA states compounded drugs containing LL-37 may pose an immunogenicity risk for some routes of administration and complexities with peptide-related impurities and characterisation of the active ingredient, that it lacks enough safety information to know whether the drug would cause harm in humans, and that nonclinical findings suggest detrimental effects on male reproduction and that LL-37 can be protumorigenic in some tissues.[src]
  • In laboratory tests, LL-37 was cytotoxic to several kinds of eukaryotic cells at 13-25 micromolar; adding human serum inhibited this cytotoxic effect.[src]
  • In the melanoma injection programme, one patient developed multiple verrucous papules and a blistering lesion with keratoacanthoma-like changes about 45 days after starting injections; the lesions resolved within 2 months of stopping.[src]
  • The melanoma study record lists skin squamous cell carcinoma (1 of 2 participants) and actinic keratosis (1 of 2) in the lower-dose cohort, and no serious adverse events or deaths; with only 3 people analysed, causality cannot be judged.[src]
  • The venous leg ulcer trial (34 participants, 4 weeks of treatment) reported no local or systemic safety concerns with topical use, but it was too small and short to detect uncommon or long-term effects.[src]
  • A 2023 laboratory and tissue study reported that LL-37 stimulated melanoma cells and macrophages to produce pro-angiogenic and invasion-related factors, and that LL-37 staining increased with melanoma T stage. This is not proof of harm in patients; tumour-promoting potential is unresolved.[src]

Around the world

Is LL-37 legal where you live?

CountryStatusWhat it meansVerified
AustraliaNot approvedNo LL-37 product is on the ARTG. It counts as an unapproved peptide, and advertising or supplying it is likely unlawful.Details →source2026-09-29
BrazilNot approvedNo Brazilian registration for LL-37; the unregistered-peptide rules applyDetails →source2026-09-29
CanadaProhibitedNot authorised; named in Health Canada's 2025 Canada Peptide seizure noticeDetails →source2026-09-29
ChinaNot approvedNo NMPA approval found for LL-37; it cannot lawfully be sold as a medicine in China.Details →source2026-09-29
European UnionNot approvedNo EU marketing authorisation; not listed in EMA or Union Register dataDetails →source2026-09-29
IndiaNot approvedNot approved in India: no CDSCO marketing permission found for LL-37; making or selling it as a medicine would be unapprovedDetails →source2026-09-29
JapanNot approvedNot an approved medicine in Japan; LL-37 is absent from PMDA's approved-drug lists and package-insert databaseDetails →source2026-09-29
MexicoNot approvedNo registration for LL-37 found in COFEPRIS listsDetails →source2026-09-29
New ZealandNot approvedNo Medsafe-approved medicine contains LL-37; antimicrobial peptides are prescription-onlyDetails →source2026-09-29
United Arab EmiratesNot approvedNot approved in the UAE: no marketing authorisation for LL-37; unapproved peptide products are under EDE enforcementDetails →source2026-09-29
United KingdomNot approvedLL-37 is not licensed in the UKDetails →source2026-09-29
United StatesNot approvedNo FDA approval; FDA notes lab findings of possible harm to male reproduction and tumour promotion, and its advisers will look at it by February 2027Details →source2026-09-29

Recent history

  1. 2026-04-15

    FDA removes 12 peptides from the 'Category 2' safety-risk list

Full timeline →

Related molecules

Sources (60)

  1. 01Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trialWound Repair and Regeneration (Grönberg A et al.) · 2014-09 · accessed 2026-09-29
  2. 02Intratumoral Injections of LL37 for Melanoma (NCT02225366)ClinicalTrials.gov (M.D. Anderson Cancer Center) · 2021-12-09 · accessed 2026-09-29
  3. 03Efficacy of LL-37 Cream on Bacteria Colonization, Inflammation Response and Healing Rate of Diabetic Foot Ulcers (NCT04098562)ClinicalTrials.gov (Universitas Indonesia) · 2019-09 · accessed 2026-09-29
  4. 04Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3Blood (Sørensen OE et al.) · 2001-06 · accessed 2026-09-29
  5. 05Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3FASEB Journal (Gombart AF et al.) · 2005-07 · accessed 2026-09-29
  6. 06Toll-like receptor triggering of a vitamin D-mediated human antimicrobial responseScience (Liu PT et al.) · 2006-03 · accessed 2026-09-29
  7. 07The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epitheliumJournal of Investigative Dermatology (Heilborn JD et al.) · 2003-03 · accessed 2026-09-29
  8. 08Conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37Journal of Biological Chemistry (Johansson J et al.) · 1998-02 · accessed 2026-09-29
  9. 09Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micellesJournal of Biological Chemistry (Wang G) · 2008-11 · accessed 2026-09-29
  10. 10LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cellsJournal of Experimental Medicine (De Yang et al.) · 2000-10 · accessed 2026-09-29
  11. 11A novel P2X7 receptor activator, the human cathelicidin-derived peptide LL37, induces IL-1 beta processing and releaseJournal of Immunology (Elssner A et al.) · 2004-04 · accessed 2026-09-29
  12. 12The antimicrobial peptide LL-37 activates innate immunity at the airway epithelial surface by transactivation of the epidermal growth factor receptorJournal of Immunology (Tjabringa GS et al.) · 2003-12 · accessed 2026-09-29
  13. 13Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptideNature (Lande R et al.) · 2007-10 · accessed 2026-09-29
  14. 14Increased serine protease activity and cathelicidin promotes skin inflammation in rosaceaNature Medicine (Yamasaki K et al.) · 2007-08 · accessed 2026-09-29
  15. 15Dermatologic toxicity from novel therapy using antimicrobial peptide LL-37 in melanoma: A detailed examination of the clinicopathologic featuresJournal of Cutaneous Pathology (Dolkar T et al.) · 2018-07 · accessed 2026-09-29
  16. 16LL-37 Might Promote Local Invasion of Melanoma by Activating Melanoma Cells and Tumor-Associated MacrophagesCancers (Ohuchi K et al.) · 2023-03 · accessed 2026-09-29
  17. 17LL-37 (PubChem CID 16198951)National Center for Biotechnology Information (PubChem) · 2026 · accessed 2026-09-29
  18. 18Bulk drug substances used in compounding that may present significant safety risks (Category 2), including the list of nominated but withdrawn substancesU.S. Food and Drug Administration · 2026-04-22 · accessed 2026-09-29
  19. 19ARTG keyword search for 'LL-37' (55 loose-match results, all pages checked; none is a LL-37 product)Therapeutic Goods Administration (TGA) · 2026-09-29 · accessed 2026-09-29
  20. 20Understanding your responsibilities when importing, compounding and supplying unapproved peptide productsTherapeutic Goods Administration (TGA) · 2026-04-13 · accessed 2026-09-29
  21. 21TGA strengthens compliance focus on unapproved peptide products as part of evolving risk responseTherapeutic Goods Administration (TGA) · 2026-06-10 · accessed 2026-09-29
  22. 22Dados abertos: registro de medicamentos (DADOS_ABERTOS_MEDICAMENTOS.csv)Agência Nacional de Vigilância Sanitária (Anvisa) · 2026-09-29 · accessed 2026-09-29
  23. 23Checamos: peptídeos que prometem milagres NÃO estão registrados na AnvisaAgência Nacional de Vigilância Sanitária (Anvisa) · 2026-07-02 · accessed 2026-09-29
  24. 24Drug Product Database API: active-ingredient search for LL-37Health Canada (Drug Product Database) · 2026-09-29 · accessed 2026-09-29
  25. 25Think twice before injecting peptides bought online: unauthorized products can seriously harm you (RA-81874)Health Canada · 2026-04-09 · accessed 2026-09-29
  26. 26Unauthorized injectable peptide drugs seized and sold by Canada Peptide may pose serious health risks (RA-77807)Health Canada · 2025-08-01 · accessed 2026-09-29
  27. 27Drug Administration Law of the PRC (中华人民共和国药品管理法)National Medical Products Administration (NMPA) · 2019-08-26 · accessed 2026-09-29
  28. 28Provisions for Drug Registration (SAMR Order No. 27; 药品注册管理办法)State Administration for Market Regulation (SAMR) · 2020-01-22 · accessed 2026-09-29
  29. 29CDE public register of accepted drug applications (受理品种目录浏览)Center for Drug Evaluation (CDE), NMPA · 2026-09-29 · accessed 2026-09-29
  30. 30EMA medicines data (JSON report): human and veterinary medicines, with authorisation statusEuropean Medicines Agency · 2026-09-29 · accessed 2026-09-29
  31. 31Union Register of medicinal products for human useEuropean Commission · 2026-09-29 · accessed 2026-09-29
  32. 32Directive 2001/83/EC on the Community code relating to medicinal products for human use (consolidated text, 1 January 2025)European Union (EUR-Lex) · 2025-01-01 · accessed 2026-09-29
  33. 33Manufacturing and marketing of unapproved drug products containing Enclomiphene and its combinations (sets out the New Drugs rule for unapproved products)Central Drugs Standard Control Organisation (CDSCO) · 2026-08-10 · accessed 2026-09-29
  34. 34CDSCO Subject Expert Committee (SEC) recommendations index (records reviewed 2015 to September 2026)Central Drugs Standard Control Organisation (CDSCO) · 2026-09-23 · accessed 2026-09-29
  35. 35Public Notice dated 18 May 2026: injectable preparations do not fall under the definition of cosmeticsCentral Drugs Standard Control Organisation (CDSCO) · 2026-05-18 · accessed 2026-09-29
  36. 36Approved new drugs list (Japanese), fiscal 2026 to date, covering approvals from May to September 2026 (承認品目一覧(新医薬品))Pharmaceuticals and Medical Devices Agency (PMDA) · 2026-09 · accessed 2026-09-29
  37. 37List of Approved Drugs, April 2004 to February 2026 (new drugs)Pharmaceuticals and Medical Devices Agency (PMDA) · 2026 · accessed 2026-09-29
  38. 38Prescription drug package insert and review report search (医療用医薬品 添付文書等情報検索)Pharmaceuticals and Medical Devices Agency (PMDA) · 2026-09-29 · accessed 2026-09-29
  39. 39Act on Securing Quality, Efficacy and Safety of Products Including Pharmaceuticals and Medical Devices (PMD Act), consolidated textDigital Agency (e-Gov Law Search) · 2026-05-21 · accessed 2026-09-29
  40. 40Personal import of pharmaceuticals and related products (医薬品等の個人輸入について)Ministry of Health, Labour and Welfare (MHLW) · 2025 · accessed 2026-09-29
  41. 41Registros sanitarios de medicamentos alopáticos expedidos 2026COFEPRIS (Comisión Federal para la Protección contra Riesgos Sanitarios) · 2026-08-04 · accessed 2026-09-29
  42. 42Listados de registros sanitarios de medicamentos (visor y listas anuales)COFEPRIS (Comisión Federal para la Protección contra Riesgos Sanitarios) · 2025-08-21 · accessed 2026-09-29
  43. 43Solicitudes de medicamentos (excepto genérico y biocomparable) ingresadas en 2026COFEPRIS (Comisión Federal para la Protección contra Riesgos Sanitarios) · 2026-08-31 · accessed 2026-09-29
  44. 44Alerta sanitaria: comercialización ilegal de productos con tirzepatida sin registro sanitarioCOFEPRIS (Comisión Federal para la Protección contra Riesgos Sanitarios) · 2026-02-09 · accessed 2026-09-29
  45. 45Data sheets index (medicines with consent to be distributed in New Zealand)Medsafe (New Zealand Medicines and Medical Devices Safety Authority) · 2026-09-29 · accessed 2026-09-29
  46. 46Medicines Classification Database (Schedule 1, Medicines Regulations 1984)Medsafe (New Zealand Medicines and Medical Devices Safety Authority) · 2026-09-25 · accessed 2026-09-29
  47. 47Consumer advisory: Unapproved peptide products health warningMedsafe (New Zealand Medicines and Medical Devices Safety Authority) · 2026-05-21 · accessed 2026-09-29
  48. 48Medicines Act 1981 (version as at 10 July 2026)New Zealand Parliamentary Counsel Office · 2026-07-10 · accessed 2026-09-29
  49. 49UAE cracks down on illegal weight-loss products, targets 71 violatorsKhaleej Times · 2026-07-25 · accessed 2026-09-29
  50. 50UAE weight-loss drug crackdown: 71 sources, 14 influencers face actionGulf News · 2026-07-25 · accessed 2026-09-29
  51. 51Pharmaceutical licensing and drug registration in the UAE (Federal Decree-Law 38 of 2024)Kayrouz and Associates · 2026-03-18 · accessed 2026-09-29
  52. 52Abu Dhabi health authority launches online form for reporting side effects from peptide productsEmirates 24|7 · 2026-09-25 · accessed 2026-09-29
  53. 53Federal Decree-Law No. (38) of 2024 on Medical Products, the Pharmacy Profession and Pharmaceutical Establishments (Arabic text)Emirates Drug Establishment (EDE) · 2024-10-01 · accessed 2026-09-29
  54. 54Find product information about medicines (MHRA Products register)Medicines and Healthcare products Regulatory Agency (MHRA) · 2026-09-25 · accessed 2026-09-29
  55. 55The Human Medicines Regulations 2012, regulation 46 (prohibition on sale or supply of unauthorised medicinal products)UK Government (legislation.gov.uk) · 2012 · accessed 2026-09-29
  56. 56Borderline products: how to tell if your product is a medicineMedicines and Healthcare products Regulatory Agency (MHRA) · 2026-07-02 · accessed 2026-09-29
  57. 57Two arrested during the MHRA's largest ever seizure of unlicensed weight loss medicinesMedicines and Healthcare products Regulatory Agency (MHRA) · 2026-05-29 · accessed 2026-09-29
  58. 58MHRA disrupts second manufacturing facility suspected to be involved in the manufacture of illegal weight loss medicinesMedicines and Healthcare products Regulatory Agency (MHRA) · 2026-02-25 · accessed 2026-09-29
  59. 59Bulk list bound? PCAC backs majority of peptides in two-day public meetingMcDermott Will & Schulte · 2026-07-27 · accessed 2026-09-29
  60. 60Bulk Drug Substances Used in Compounding Under Section 503A of the FD&C ActU.S. Food and Drug Administration · 2026-05-14 · accessed 2026-09-29